General Information

  • ID:  hor006730
  • Uniprot ID:  P31824
  • Protein name:  Acyl-CoA-binding protein homolog
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  ACBP family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  MSLQEQFDQAASNVRNLKSLPSDNDLLELYALFKQASAGDADPANRPGLLDLKGKAKFDAWHKKAGLSKEDAQKAYIAKVESLIASLGLQ
  • Length:  90(1-90)
  • Propeptide:  MSLQEQFDQAASNVRNLKSLPSDNDLLELYALFKQASAGDADPANRPGLLDLKGKAKFDAWHKKAGLSKEDAQKAYIAKVESLIASLGLQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P31824-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P31824-F1.pdbhor006730_AF2.pdbhor006730_ESM.pdb

Physical Information

Mass: 1136183 Formula: C434H697N119O135S
Absent amino acids: CT Common amino acids: AL
pI: 7.53 Basic residues: 13
Polar residues: 19 Hydrophobic residues: 36
Hydrophobicity: -43.11 Boman Index: -14382
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 91.33
Instability Index: 4560.56 Extinction Coefficient cystines: 8480
Absorbance 280nm: 95.28

Literature

  • PubMed ID:  8375571
  • Title:  A diazepam binding inhibitor (DBI) homolog from the tobacco hornworm, Manduca sexta.